PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn198751
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 767aa    MW: 85868 Da    PI: 4.8938
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn198751genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26068.31.7e-2156363429100
      DUF260  29 kfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                  f n+hklFG sn++kl+++l++ e+++am+++++++++ra+dPv G++++i++lqqq+e  kael l+ ++
  Achn198751 563 GFLNAHKLFGISNITKLIRNLDPPEKDQAMRTIIFQSDVRANDPVGGCYRIISELQQQIEYYKAELGLVLQQ 634
                 599**************************************************************9887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.20.20.801.9E-442223IPR013781Glycoside hydrolase, catalytic domain
PfamPF013017.0E-422224IPR031330Glycoside hydrolase 35, catalytic domain
SuperFamilySSF514456.74E-322220IPR017853Glycoside hydrolase superfamily
PRINTSPR007425.7E-151934IPR001944Glycoside hydrolase, family 35
PROSITE patternPS0118202133IPR019801Glycoside hydrolase, family 35, conserved site
PRINTSPR007425.7E-15200216IPR001944Glycoside hydrolase, family 35
SuperFamilySSF497855.53E-20343384IPR008979Galactose-binding domain-like
Gene3DG3DSA:2.60.120.2603.1E-20346466IPR008979Galactose-binding domain-like
SuperFamilySSF497855.53E-20418478IPR008979Galactose-binding domain-like
PRINTSPR007425.7E-15450466IPR001944Glycoside hydrolase, family 35
PROSITE profilePS5089112.979532635IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-18563629IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0004553Molecular Functionhydrolase activity, hydrolyzing O-glycosyl compounds
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MVERWWGVLL PLIAPLLYSN GGPIIMVQIE NEFGSYGDDK VYLHHLVTLA RGHLGDDIIL  60
YTTDGGSRET LEKGTIHGDA VFSVWLSFHN EDINYVKLYH DPSAITQATS GTIIGTTTTF  120
TTTEAIVLIN SAFWSLLEFY TGWLTHWGEN IAKTDAHFTA AALEMILSRN GSAVLYMAHG  180
GTNFGFYCGA NTGANKSDYK PDLTSYDYDA PIKESGDVDN AKFIVPSNNE KTGYGHIQLQ  240
KTAFLFDTLN IEDATDVSKS ISPISMESAG QMFGFLLYVS RYAATYNERT LFIEEVHDRA  300
QVFISCPSDS KRPTYIGTIE RWSNRPLGLP YTDCPSKIRL FILVENMGRV NYGKFMFDRK  360
GILSSVYLDG ELLHSWKMFS VPFQNLNDKQ KGNPIIQSAY LDIIKSSADK KLEDISDNSS  420
EEPAFFAGYF TVDKASQLKD TFISFRGWGK GIAFVNEFNI GRFWPVILEL DSPNPELVVT  480
SVDQPDFTCG SSSSKVTELT NQFEKCQQLL NSISGSINAK AMTVEGQKRK LEESEQLLNQ  540
RKNVPVRGSG TGTLQALNHD MIGFLNAHKL FGISNITKLI RNLDPPEKDQ AMRTIIFQSD  600
VRANDPVGGC YRIISELQQQ IEYYKAELGL VLQQLAICCA SHQSRTSLTY GLEDLSTLNC  660
ESIVNPMSND RIQETHEEEY FLHDNNNVVP LQDIVAWAMQ DTVSASLHDK KTFVNECDDV  720
KPTVLEIGGE RLELKFDHEE EKIQHSDEAI SKDKGILRLP PSFLKM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4mad_A5e-732466141553Beta-galactosidase
4mad_B5e-732466141553Beta-galactosidase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006426555.10.0hypothetical protein CICLE_v10024990mg
SwissprotQ93Z240.0BGA17_ARATH; Beta-galactosidase 17
TrEMBLV4SLQ40.0V4SLQ4_9R
STRINGGLYMA13G42560.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA652222
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-37LOB domain-containing protein 22